• DRAMP ID

    • DRAMP03737
    • Peptide Name

    • Opistoporin-4 (Non-disulfide-bridged peptides 3.7, NDBP-3.7; Arthropods, animals)
    • Source

    • Opistophthalmus carinatus (African yellow leg scorpion)
    • Family

    • Belongs to the antimicrobial peptide scorpion family
    • Gene

    • Not found
    • Sequence

    • GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS
    • Sequence Length

    • 44
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

    • [Swiss_Prot Entry Q5VJS9]strong antibacterial activity against Gram-negative bacteria but is less active against Gram-positive bacteria. Also has antifungal activity.
    • Hemolytic Activity

      • [Swiss_Prot Entry Q5VJS9]Weak hemolytic activity against human erythrocytes
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Cell membrane
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C217H356N60O62
    • Absent Amino Acids

    • CHMRY
    • Common Amino Acids

    • K
    • Mass

    • 4797.58
    • PI

    • 9.9
    • Basic Residues

    • 9
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 19
    • Net Charge

    • +5
    • Boman Index

    • -64.01
    • Hydrophobicity

    • -0.482
    • Aliphatic Index

    • 86.59
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11000
    • Absorbance 280nm

    • 255.81
    • Polar Residues

    • 10

DRAMP03737

DRAMP03737 chydropathy plot
    • Function

    • At high concentrations, acts as pore former in cellular membranes and causes the leakage of the cells. At submicromolar concentrations, degranulates granulocytes and has weak hemolytic activity against human red blood cells. Also strongly inhibits the production of superoxide anions. Has a strong antibacterial activity against Gram-negative bacteria but is less active against Gram-positive bacteria. Also has antifungal activity. (By similarity)
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Precursor organization and gene structure of scorpion venom antimicrobial peptides.
    • Reference

    • Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
    • Author

    • Zhu S, Tytgat J.