• DRAMP ID

    • DRAMP03786
    • Peptide Name

    • Neuropeptide-like protein 30 (NLP-30; Gly-rich, Tyr-rich; nematodes, animals; Predicted)
    • Source

    • Caenorhabditis elegans
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • QWGYGGYGRGYGGYGGYGRGYGGYGRGYGGYGRGMWGRPYGGYGWGK
    • Sequence Length

    • 47
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Predicted
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03786.
    • Formula

    • C231H299N67O60S
    • Absent Amino Acids

    • ACDEFHILNSTV
    • Common Amino Acids

    • G
    • Mass

    • 5006.39
    • PI

    • 9.85
    • Basic Residues

    • 6
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 3
    • Net Charge

    • +6
    • Boman Index

    • -55.33
    • Hydrophobicity

    • -1.196
    • Aliphatic Index

    • 0
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 32890
    • Absorbance 280nm

    • 715
    • Polar Residues

    • 35

DRAMP03786

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM.
    • Reference

    • Nat Immunol. 2004 May;5(5):488-494.
    • Author

    • Couillault C, Pujol N, Reboul J, Sabatier L, Guichou JF, Kohara Y, Ewbank JJ.