General Information

    • DRAMP ID

    • DRAMP03787

    • Peptide Name

    • Neuropeptide-like protein 31 (NLP-31; nematodes, animals)

    • Source

    • Caenorhabditis elegans

    • Family

    • Belongs to the YARP family

    • Gene

    • nlp-31

    • Sequence

    • NAQWGYGGYGRGYGGYGGYGRGYGGYGGYGRGYGGYGRGMYGGYGRPYGGYGWGK

    • Sequence Length

    • 55

    • Protein Existence

    • Transcript level

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacterium:
        Target OrganismActivity
        Micrococcus luteus;-
      • Gram-negative bacterium:
        Target OrganismActivity
        E.coli-
      • Fungi:
        Target OrganismActivity
        D.coniospora-

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03787.

Physicochemical Information

    • Formula

    • C262H339N75O72S

    • Absent Amino Acids

    • CDEFHILSTV

    • Common Amino Acids

    • G

    • Mass

    • 5723.09

    • PI

    • 9.7

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 3

    • Net Charge

    • +6

    • Boman Index

    • -59.15

    • Hydrophobicity

    • -1.136

    • Aliphatic Index

    • 1.82

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 31860

    • Absorbance 280nm

    • 590

    • Polar Residues

    • 43

DRAMP03787

Comments Information

    • Function

    • Antimicrobial peptide that has antifungal and weak antibacterial activity.

    • Tissue specificity

    • Expressed in hypoderm.

    • Developmental stage

    • Expressed in precomma stasge embryos.

    • Induction

    • Strongly up-regulated upon D. coniospora infection.

    • PTM

    • C-terminal amidation.

Literature Information

  • ·Literature 1

    • Title

    • Identification of neuropeptide-like protein gene families in Caenorhabditis elegans and other species.

    • Reference

    • Proc Natl Acad Sci U S A. 2001 Nov 20;98(24):14000-5.

    • Author

    • Nathoo AN, Moeller RA, Westlund BA, Hart AC.
  • ·Literature 2

    • Title

    • TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM.

    • Reference

    • Nat Immunol. 2004 May;5(5):488-494.

    • Author

    • Couillault C, Pujol N, Reboul J, Sabatier L, Guichou JF, Kohara Y, Ewbank JJ.