General Information

    • DRAMP ID

    • DRAMP03790

    • Peptide Name

    • ABF-2 (nematodes, animals)

    • Source

    • Caenorhabditis elegans

    • Family

    • Not found

    • Gene

    • abf-2

    • Sequence

    • DIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG

    • Sequence Length

    • 67

    • Protein Existence

    • Predicted

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtilis IFO3134BC50=0.09 µM
        Kocuria varians MAFF118076BC50=0.008 µM
        Staphylococcus aureus ATCC6538P (BC50=0.005 µM);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Agrobacterium tumefaciens MAFF1001BC50=0.05 µM
        Bdellovibrio bacteriovorus MAFF106101BC50=0.06 µM
        Klebsiella pneumoniae MAFF519002BC50=0.9 µM
        Escherichia coli JM109BC50>15 µM
      • Fungi:
        Target OrganismActivity
        Candida krusei MAFF114085BC50=0.3 µM
        Debaryomyces hansenii MAFF113836BC50>15 µM
        Kluyveromyces thermotolerans MAFF113848BC50=0.3 µM
        Paeonia anomala MAFF113717BC50=0.08 µM
        Saccharomyces cerevisiae MAFF113011BC50=0.6 µM
        Torulaspora delbrueckiiMAFF113811BC50>15 µM

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Predicted Structure

    • There is no predicted structure for DRAMP03790.

Physicochemical Information

    • Formula

    • C289H489N91O90S10

    • Absent Amino Acids

    • EHW

    • Common Amino Acids

    • GC

    • Mass

    • 6999.22

    • PI

    • 9.08

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +6

    • Boman Index

    • -101.22

    • Hydrophobicity

    • -0.072

    • Aliphatic Index

    • 68.51

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 30.15

    • Polar Residues

    • 29

DRAMP03790

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • abf-1 and abf-2, ASABF-type antimicrobial peptide genes in Caenorhabditis elegans.

    • Reference

    • Biochem J. 2002 Jan 15;361(Pt 2):221-230.

    • Author

    • Kato Y, Aizawa T, Hoshino H, Kawano K, Nitta K, Zhang H.