General Information

    • DRAMP ID

    • DRAMP03791

    • Peptide Name

    • Caenacin-1 (Gly-rich, Tyr-rich; CNC-1; nematode, invertebrate, animals)

    • Source

    • Caenorhabditis elegans

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QWGYNSYGYGNYGGYGGYPMYGGYGMNGGYGGGGLLGMFLGKKK

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Predicted

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03791.

Physicochemical Information

    • Formula

    • C213H290N52O59S3

    • Absent Amino Acids

    • ACDEHIRTV

    • Common Amino Acids

    • G

    • Mass

    • 4619.14

    • PI

    • 9.31

    • Basic Residues

    • 3

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +3

    • Boman Index

    • -2.73

    • Hydrophobicity

    • -0.636

    • Aliphatic Index

    • 26.59

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18910

    • Absorbance 280nm

    • 439.77

    • Polar Residues

    • 31

DRAMP03791

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM.

    • Reference

    • Nat Immunol. 2004 May;5(5):488-494.

    • Author

    • Couillault C, Pujol N, Reboul J, Sabatier L, Guichou JF, Kohara Y, Ewbank JJ.