• DRAMP ID

    • DRAMP03809
    • Peptide Name

    • Pardaxin P-1 (Pardaxin Pa1)
    • Source

    • Pardachirus pavoninus (Peacock sole) (Achirus pavoninus)
    • Family

    • Belongs to the pardaxin family
    • Gene

    • Not found
    • Sequence

    • GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Cytotoxic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Cell membrane
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C157H252N36O47
    • Absent Amino Acids

    • CDHMNRWY
    • Common Amino Acids

    • S
    • Mass

    • 3395.94
    • PI

    • 6.14
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • 0
    • Boman Index

    • 3.96
    • Hydrophobicity

    • 0.652
    • Aliphatic Index

    • 112.42
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 11

DRAMP03809

    • Function

    • Exhibits unusual shark repellent and surfactant properties. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis. Causes death in killfish oryzias latipes in 30 minutes at a concentration of 25 micrograms/ml.
    • Subunit structure

    • In aqueous solution exists as a tetramer.
    • Domain

    • Consists of a C-terminal hydrophilic region and a predominantly hydrophobic remainder.
  • ·Literature 1
    • Title

    • Melittin-like peptides from the shark-repelling defense secretion of the sole Pardachirus pavoninus.
    • Reference

    • Science. 1986 Jul 18;233(4761):341-343.
    • Author

    • Thompson SA, Tachibana K, Nakanishi K, Kubota I.