• DRAMP ID

    • DRAMP03810
    • Peptide Name

    • Pardaxin P-2 (Pardaxin Pa2)
    • Source

    • Pardachirus pavoninus (Peacock sole) (Achirus pavoninus)
    • Family

    • Belongs to the pardaxin family
    • Gene

    • Not found
    • Sequence

    • GFFALIPKIISSPIFKTLLSAVGSALSSSGGQE
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Cytotoxic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Cell membrane
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix
    • Structure Description

    • Pardaxin P-2 adopts a novel amphiphilic helix (7-11)-bend (12-13)-helix (14-26) motif with Pro-13 forming the focal point of the turn or bend between the two helices.(Ref.2)
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C154H248N36O45
    • Absent Amino Acids

    • CDHMNRWY
    • Common Amino Acids

    • S
    • Mass

    • 3323.88
    • PI

    • 8.59
    • Basic Residues

    • 2
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +1
    • Boman Index

    • 11.71
    • Hydrophobicity

    • 0.767
    • Aliphatic Index

    • 112.42
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 12

DRAMP03810

    • Function

    • Exhibits unusual shark repellent and surfactant properties. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.
    • Subunit structure

    • In aqueous solution exists as a tetramer.
    • Domain

    • Consists of a C-terminal hydrophilic region and a predominantly hydrophobic remainder.
  • ·Literature 1
    • Title

    • Melittin-like peptides from the shark-repelling defense secretion of the sole Pardachirus pavoninus.
    • Reference

    • Science. 1986 Jul 18;233(4761):341-343.
    • Author

    • Thompson SA, Tachibana K, Nakanishi K, Kubota I.
  • ·Literature 2
    • Title

    • Solution structure of pardaxin P-2.
    • Reference

    • Biochemistry. 1991 Aug 13;30(32):8009-8017.
    • Author

    • Zagorski MG, Norman DG, Barrow CJ, Iwashita T, Tachibana K, Patel DJ.