• DRAMP ID

    • DRAMP03812
    • Peptide Name

    • Pardaxin P-4 (Pardaxin P1a; Pardaxin Pa4)
    • Source

    • Pardachirus marmoratus (Finless sole) (Achirus marmoratus)
    • Family

    • Belongs to the pardaxin family
    • Gene

    • Not found
    • Sequence

    • GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Cytotoxic
    • Target Organism

      • [Ref.23598079] Gram-positive bacteria:
        Target OrganismActivity
        Micrococcus luteusMIC=100 mg/L
        Staphylococcus aureusMIC=50 mg/L
        Streptococcus pneumoniaeMIC=100 mg/L
        Streptococcus agalactiaeMIC=100 mg/L
        Staphylococcus sp.MIC=6.25 mg/L
      • Gram-negative bacteria:
        Target OrganismActivity
        Grouper Vibrio alginolyticusMIC=50 mg/L
        Vibrio harveyiMIC=50 mg/L
        Vibrio vulnificusMIC=100 mg/L
    • Hemolytic Activity

      • [Ref.23598079] 7% hemolysis at 12.5 mg/L , 10% hemolysis at 25 mg/L , 27% hemolysis at 50 mg/L , 55% hemolysis at 100 mg/L , 95% hemolysis at 200 mg/L , 90% hemolysis at 400 mg/L against sheep red blood cells
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Cell membrane
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix (2 helices; 15 residues)
    • Structure Description

    • The peptide adopts a bend-helix-bend-helix motif with an angle between the two structure helices of 122 +/- 9 degrees, making this structure substantially different from the one previously determined in organic solvents.
    • Predicted Structure

    • Formula

    • C154H248N36O45
    • Absent Amino Acids

    • CDHMNRWY
    • Common Amino Acids

    • S
    • Mass

    • 3323.88
    • PI

    • 8.59
    • Basic Residues

    • 2
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +1
    • Boman Index

    • 11.71
    • Hydrophobicity

    • 0.746
    • Aliphatic Index

    • 112.42
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 12

DRAMP03812

    • Function

    • Exhibits unusual shark repellent and surfactant properties. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.
    • Domain

    • Consists of a C-terminal hydrophilic region and a predominantly hydrophobic remainder. Function
  • ·Literature 1
    • Title

    • Membrane composition determines pardaxin's mechanism of lipid bilayer disruption.
    • Reference

    • Biophys J. 2002 Aug;83(2):1004-1013.
    • Author

    • Hallock KJ, Lee DK, Omnaas J, Mosberg HI, Ramamoorthy A.
  • ·Literature 2
    • Title

    • NMR structure of pardaxin, a pore-forming antimicrobial peptide, in lipopolysaccharide micelles: mechanism of outer membrane permeabilization.
    • Reference

    • J Biol Chem. 2010 Feb 5;285(6):3883-3895.
    • Author

    • Bhunia A, Domadia PN, Torres J, Hallock KJ, Ramamoorthy A, Bhattacharjya S.
  • ·Literature 3
    • Title

    • Structure and orientation of pardaxin determined by NMR experiments in model membranes.
    • Reference

    • J Biol Chem. 2004 Oct 29;279(44):45815-23.
    • Author

    • Porcelli F, Buck B, Lee DK, Hallock KJ, Ramamoorthy A, Veglia G.
  • ·Literature 4
    • Title

    • Truncated antimicrobial peptides from marine organisms retain anticancer activity and antibacterial activity against multidrug-resistant Staphylococcus aureus.
    • Reference

    • Peptides. 2013 Jun;44:139-48.
    • Author

    • Lin MC, Hui CF, Chen JY, Wu JL