• DRAMP ID

    • DRAMP18419
    • Peptide Name

    • STiDA-2
    • Source

    • Deduced; synthetic
    • Family

    • Belongs to the defensin family.
    • Gene

    • Not found
    • Sequence

    • GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKARPPFILG
    • Sequence Length

    • 55
    • UniProt Entry

    • No entry found
    • Protein Existence

    • SMILES

    • Not available
    • Biological Activity

    • Antiparasitic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C263H400N82O69S7
    • Absent Amino Acids

    • EVW
    • Common Amino Acids

    • G
    • Mass

    • 6057.01
    • PI

    • 9.42
    • Basic Residues

    • 11
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +10
    • Boman Index

    • -9000
    • Hydrophobicity

    • -0.698
    • Aliphatic Index

    • 36.61
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 88.09
    • Polar Residues

    • 25

DRAMP18419

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.
    • Reference

    • Front Microbiol. 2016 Oct 24;7:1682
    • Author

    • Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald