• DRAMP ID

    • DRAMP18422
    • Peptide Name

    • DefMT2 (defensin MT2;hard ticks, arachnids, arthropods, invertebrates, animals)
    • Source

    • Ixodes ricinus
    • Family

    • Belongs to the defensin family.
    • Gene

    • Not found
    • Sequence

    • GYFCPYNGYCDHHCRKKLRWRGGYCGGRWKLTCICVRG
    • Sequence Length

    • 38
    • UniProt Entry

    • No entry found
    • Protein Existence

    • SMILES

    • Not available
    • Biological Activity

    • Antiparasitic, Antimalarial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C199H293N63O46S6
    • Absent Amino Acids

    • AEMQS
    • Common Amino Acids

    • G
    • Mass

    • 4514.29
    • PI

    • 9.46
    • Basic Residues

    • 10
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +9
    • Boman Index

    • -7836
    • Hydrophobicity

    • -0.656
    • Aliphatic Index

    • 37.44
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 17335
    • Absorbance 280nm

    • 456.18
    • Polar Residues

    • 19

DRAMP18422

    • Fuction

    • The peptide showed no activity against bacteria. It showed antimalarial activity.
  • ·Literature 1
    • Title

    • Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.
    • Reference

    • Front Microbiol. 2016 Oct 24;7:1682.
    • Author

    • Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald
  • ·Literature 2
    • Title

    • Ixodes ricinus defensins attack distantly-related pathogens.
    • Reference

    • Dev Comp Immunol. 2015 Dec;53(2):358-65.
    • Author