• • DRAMP ID

  • DRAMP20934

• • Peptide Name

  • Lucilin Peptide

• • Source

  • L. eximia maggots

• • Family

  • Cecropins

• • Gene

  • ATGAATTTTAATAAATTTTT

• • Sequence

  • MNFNKFFVLFALIMVAVVGQSEAGWLKKLGKKIERVGQHTRDATIQTIGVAQQAVNVAATLKG

• • Sequence Length

  • 63

• • UniProt Entry

  • D7RT24

• • Protein Existence

  • Transcript level

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)CC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CCSC)C(C)C)[C@H](C)CC)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)[C@H](C)CC)C(C)C)[C@@H](C)O)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)NCC(=O)O)[C@@H](C)O)C(C)C)[C@H](C)CC)[C@@H](C)O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O)C(C)C)C(C)C)[C@@H](C)O

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram-, Wound-healing

• • Target Organism

  • • [Ref.29890152] Gram-negative bacteria:

      Target Organism	Activity
      Escherichia coli DH10B	MIC=7.8 μg/ml; MBC=7.8 μg/ml
      Escherichia coli ESBL	MIC=15.6 μg/ml; MBC=15.6 μg/ml
      Enterobacter cloacae	MIC=125 μg/ml; MBC=125 μg/ml

• • Hemolytic Activity

  • • [Ref.29890152]Hemolysis 0% at 0.24 μg/ml, hemolysis 0% at 0.49 μg/ml, hemolysis 0% at 0.98 μg/ml, hemolysis 0% at 1.95 μg/ml, hemolysis 0% at 3.91 μg/ml, hemolysis 0% at 7.81 μg/ml, hemolysis 0% at 15.60 μg/ml, hemolysis 0% at 31.00 μg/ml, hemolysis 0% at 63.00 μg/ml, hemolysis 0% at 125.00 μg/ml, hemolysis 0% at 250.00 μg/ml against human red blood cell

• • Cytotoxicity

  • • [Ref.29890152] The peptide did not show cytotoxic activities against Vero cells.
    • The peptide showed a toxic concentration from 62.5 μg/ml with IC50 of 58.30 μg/ml against PBMCs

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP20934_predicted_structure.pdb to download.

DRAMP20934

• • Function

  • Antibacterial activity against the Gram-negative bacteria. Immunomodulatory activity. Decreasing the TNF-alpha production in PBMCs and inducing cellular migration in human keratinocytes.

• ·Literature 1

• • Title

  • Identification, Characterization, Immunolocalization, and Biological Activity of Lucilin Peptide.

• • Pubmed ID

  • 29890152

• • Reference

  • Bioorg Med Chem Lett. 2012 Jun 15;22(12):4185-8.

• • Author

  • Téllez GA, Zapata JA, Toro LJ, Henao DC, Bedoya JP, Rivera JD, Trujillo JV, Rivas-Santiago B, Hoyos RO, Castano JC.