• DRAMP ID

    • DRAMP29099
    • Peptide Name

    • CAP18
    • Source

    • Oryctolagus cuniculus
    • Family

    • Not found
    • Gene

    • camp
    • Sequence

    • GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
    • Sequence Length

    • 37
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial,Anti-Gram+,Anti-Gram-
    • Target Organism

      • [Ref.11557478]Gram-negative bacteria:
        Target OrganismActivity
        Pseudomonas aeruginosa(MIC=1-32 µg/ml); Pseudomonas aeruginosa(MIC50=4 µg/ml); Pseudomonas aeruginosa(MIC90=16 µg/ml); Stenotrophomonas maltophilia(MIC=2-16 µg/ml); Achromobacter xylosoxidansMIC=2-32 µg/ml
      • [Ref.10768969]Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC 33591(MIC=1.24 µM ); Staphylococcus aureus ATCC 33591(100 mM NaCl,MIC=1.36 µM); Staphylococcus aureus 930918-3(MIC=0.41 µM); Staphylococcus aureus 930918-3(100 mM NaCl,MIC=0.63 µM);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Pseudomonas aeruginosa PAO1(25 mM NaCl,EC50=0.22±0.05 µM); Pseudomonas aeruginosa PAO1(175 mM NaCl, EC50=0.11±0.02 µM); Escherichia coli DH5α(MIC=0.19 µM); Escherichia coli DH5α(100 mM NaCl, MIC=0.21 µM); Escherichia coli ML-35p(MIC=0.05 µM); Escherichia coli ML-35p(100 mM NaCl, MIC=0.09 µM); Pseudomonas aeruginosa PAO1(MIC=0.20 µM); Pseudomonas aeruginosa PAO1(100 mM NaCl, MIC=0.62 µM); Pseudomonas aeruginosa MR3007(MIC=0.05 µM); Pseudomonas aeruginosa MR3007100 mM NaCl, MIC=0.36 µM
      • [Ref.26656394]Gram-negative bacteria:
        Target OrganismActivity
        Yersinia ruckeri 392/2003(MIC=2-4 µg/ml); Aeromonas salmonicida ATCC 49385(MIC=2 µg/ml); Salmonella enterica serovar Typhimurium LT2(MIC=4-8 µg/ml); Campylobacter jejuni NCTC 11168(MIC=1 µg/ml); Escherichia coli ATCC 25922(MIC=4-8 µg/ml ); Pseudomonas aeruginosa ATCC 27853(MIC=4-8 µg/ml); Escherichia coli BW25113(MIC=4-8 µg/ml); Escherichia coli BW25113 del-rfaC(MIC=4 µg/ml); Escherichia coli ATCC 25922 del-rfaC(MIC=2 µg/ml);-
      • Gram-positive bacterial:
        Target OrganismActivity
        Flavobacterium psychrophilum 1947(MIC>>256 µg/ml); Staphylococcus aureus ATCC 29213(MIC>=32 µg/ml); Enterococcus faecalis ATCC 29212(MIC=8 µg/ml); Listeria monocytogenes N22-2MIC=2-4 µg/ml
      • [Ref.30245684]Gram-negative bacterial:
        Target OrganismActivity
        Escherichia coli ATCC 25922 del-waaC(MIC=2-4 µg/ml); Escherichia coli ATCC 25922 del-waaE(MIC=4 µg/ml); Escherichia coli ATCC 25922 del-waaF(MIC=2-4 µg/ml); Escherichia coli ATCC 25922 del-waaG(MIC=4 µg/ml); Escherichia coli JW3596(MIC=4 µg/ml); Escherichia coli JW1667MIC=2-4 µg/ml
      • [Ref.29852015]Gram-negative bacterial:
        Target OrganismActivity
        Aeromonas salmonicida ATCC 33658(MIC=4 µg/ml);-
      • Gram-positive bacterial:
        Target OrganismActivity
        Lactococcus lactis IL1403MIC=1-2 µg/ml
    • Hemolytic Activity

      • [Ref.10768969]non-hemolysis against Human erythrocytes up to 500 µg/ml.
      • [Ref.26656394]1% hemolysis against Horse erythrocytes at 64 µg/ml.
    • Cytotoxicity

      • Not found
    • Binding Target

    • liposomes
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Alpha helix
    • Structure Description

    • The peptide adopted an appreciable α-helical content in the presence of the organic cosolvent 40% trifluoroethanol and in the presence of 0.1% lipopolysaccharide.
    • Helical Wheel Diagram

    • DRAMP29099 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP29099.
    • Formula

    • C202H356N64O47
    • Absent Amino Acids

    • CHMSVW
    • Common Amino Acids

    • K
    • Mass

    • 4433.45
    • PI

    • 11.54
    • Basic Residues

    • 14
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +12
    • Boman Index

    • -10862
    • Hydrophobicity

    • -1.097
    • Aliphatic Index

    • 97.57
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 41.39
    • Polar Residues

    • 6

DRAMP29099

DRAMP29099 chydropathy plot
    • Function

    • Antibacterial activity against Gram-positive bacteria and Gram-negative bacteria.CAP18 were active against P. aeruginosa, E. coli, S. aureus, and MRSA.
  • ·Literature 1
    • Title

    • Cathelicidin peptides inhibit multiply antibiotic-resistant pathogens from patients with cystic fibrosis.
    • Reference

    • Antimicrob Agents Chemother. 2001 Oct;45(10):2838-2844.
    • Author

    • Saiman L, Tabibi S, Starner TD, San Gabriel P, Winokur PL, Jia HP, McCray PB Jr, Tack BF.
  • ·Literature 2
    • Title

    • Bactericidal activity of mammalian cathelicidin-derived peptides.
    • Reference

    • Infect Immun. 2000 May;68(5):2748-2755.
    • Author

    • Travis SM, Anderson NN, Forsyth WR, Espiritu C, Conway BD, Greenberg EP, McCray PB Jr, Lehrer RI, Welsh MJ, Tack BF.
  • ·Literature 3
    • Title

    • Comparative Evaluation of the Antimicrobial Activity of Different Antimicrobial Peptides against a Range of Pathogenic Bacteria.
    • Reference

    • PLoS One. 2015 Dec 11;10(12):e0144611.
    • Author

    • Ebbensgaard A, Mordhorst H, Overgaard MT, Nielsen CG, Aarestrup FM, Hansen EB.
  • ·Literature 4
    • Title

    • The Role of Outer Membrane Proteins and Lipopolysaccharides for the Sensitivity of Escherichia coli to Antimicrobial Peptides.
    • Reference

    • Front Microbiol. 2018 Sep 7;9:2153.
    • Author

    • Ebbensgaard A, Mordhorst H, Aarestrup FM, Hansen EB.
  • ·Literature 5
    • Title

    • Dissection of the antimicrobial and hemolytic activity of Cap18: Generation of Cap18 derivatives with enhanced specificity.
    • Reference

    • PLoS One. 2018 May 31;13(5):e0197742.
    • Author

    • Ebbensgaard A, Mordhorst H, Overgaard MT, Aarestrup FM, Hansen EB.