• DRAMP ID

    • DRAMP31555
    • Peptide Name

    • CHR-1, Env GP (623-658)
    • Source

    • Synthetic construct
    • Family

    • Retroviridae
    • Gene

    • Not found
    • Sequence

    • WNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQ
    • Sequence Length

    • 36
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antiviral
    • Target Organism

      • [Ref.17276993]human immunodeficiency virus (HIV): inhibition of cell-cell fusion in MT-2 cells(IC50=17.27 ± 0.31 nM; IC90=26.41 ± 0.55 nM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • No cytotoxicity information or data found in the reference(s) presented in this entry
    • Binding Target

    • cell membrane
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP31555 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP31555.
    • Formula

    • C196H288N56O67S
    • Absent Amino Acids

    • ACFGPV
    • Common Amino Acids

    • E
    • Mass

    • 4532.84
    • PI

    • 4.53
    • Basic Residues

    • 4
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 8
    • Net Charge

    • -3
    • Boman Index

    • -11884
    • Hydrophobicity

    • -1.564
    • Aliphatic Index

    • 54.17
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 17990
    • Absorbance 280nm

    • 514
    • Polar Residues

    • 12

DRAMP31555

DRAMP31555 chydropathy plot
    • Mechanism

    • The peptide can interact with the viral NHR to form stable heterologous 6-HBs, resulting in inhibition of fusion between the viral and target cell membranes.
  • ·Literature 1
    • Title

    • HIV gp41 C-terminal heptad repeat contains multifunctional domains. Relation to mechanisms of action of anti-HIV peptides
    • Reference

    • J Biol Chem. 2007 Mar 30;282(13):9612-9620.
    • Author

    • Liu S, Jing W, Cheung B, Lu H, Sun J, Yan X, Niu J, Farmar J, Wu S, Jiang S.