General Information

    • DRAMP ID

    • DRAMP31555

    • Peptide Name

    • CHR-1, Env GP (623-658)

    • Source

    • Synthetic construct

    • Family

    • Retroviridae

    • Gene

    • Not found

    • Sequence

    • WNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQ

    • Sequence Length

    • 36

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

      • [Ref.17276993]human immunodeficiency virus (HIV): inhibition of cell-cell fusion in MT-2 cells(IC50=17.27 ± 0.31 nM; IC90=26.41 ± 0.55 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • No cytotoxicity information or data found in the reference(s) presented in this entry

    • Binding Target

    • cell membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP31555 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP31555.

Physicochemical Information

    • Formula

    • C196H288N56O67S

    • Absent Amino Acids

    • ACFGPV

    • Common Amino Acids

    • E

    • Mass

    • 4532.84

    • PI

    • 4.53

    • Basic Residues

    • 4

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 8

    • Net Charge

    • -3

    • Boman Index

    • -11884

    • Hydrophobicity

    • -1.564

    • Aliphatic Index

    • 54.17

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 17990

    • Absorbance 280nm

    • 514

    • Polar Residues

    • 12

DRAMP31555

DRAMP31555 chydropathy plot

Comments Information

    • Mechanism

    • The peptide can interact with the viral NHR to form stable heterologous 6-HBs, resulting in inhibition of fusion between the viral and target cell membranes.

Literature Information

  • ·Literature 1

    • Title

    • HIV gp41 C-terminal heptad repeat contains multifunctional domains. Relation to mechanisms of action of anti-HIV peptides

    • Reference

    • J Biol Chem. 2007 Mar 30;282(13):9612-9620.

    • Author

    • Liu S, Jing W, Cheung B, Lu H, Sun J, Yan X, Niu J, Farmar J, Wu S, Jiang S.