General Information

    • DRAMP ID

    • DRAMP32449

    • Peptide Name

    • B6

    • Source

    • Hedyotis biflora

    • Family

    • Gene

    • Not found

    • Sequence

    • GAVPCGETCVYLPCITAAIGCSCQNKVCYRD

    • Sequence Length

    • 31

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Anticancer

    • Target Organism

      • Tumor cells:
        Target OrganismActivity
        Capan-2 (IC50=1.85 μM); PANC-1 (IC50=1.97 μM); MOH-1 (IC50=2.10 μM); BxPC-3IC50=2.33 μM

    • Hemolytic Activity

      • Not available

    • Cytotoxicity

      • Not available

    • Binding Target

    • Not available

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP32449 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP32449.

Physicochemical Information

    • Formula

    • C135H217N37O43S6

    • Absent Amino Acids

    • FHMW

    • Common Amino Acids

    • C

    • Mass

    • 377411

    • PI

    • 6.02

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • 0

    • Boman Index

    • -1419

    • Hydrophobicity

    • 0.458

    • Aliphatic Index

    • 75.48

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 111.83

    • Polar Residues

    • 15

DRAMP32449

DRAMP32449 chydropathy plot

Comments Information

    • Not available

Literature Information

  • ·Literature 1

    • Title

    • Novel cyclotides from Hedyotis biflora inhibit proliferation and migration of pancreatic cancer cell in vitro and in vivo

    • Reference

    • Author