• DRAMP ID

    • DRAMP32451
    • Peptide Name

    • B7
    • Source

    • Hedyotis biflora
    • Family

    • Gene

    • Not found
    • Sequence

    • GISCAETCVLLPCLSSVIGCTCQNKRCYKN
    • Sequence Length

    • 30
    • Protein Existence

    • Not found
    • SMILES

    • CC[C@@H](C)[C@H](NC(=O)CN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)O)[C@@H](C)O)[C@H](C)CC)C(C)C)C(C)C)[C@@H](C)O
    • Biological Activity

    • Antimicrobial, Anticancer
    • Target Organism

      • Tumor cells:
        Target OrganismActivity
        MOH-1 (IC50=0.33 μM); PANC-1 (IC50=0.36 μM); Capan-2 (IC50=0.45 μM); BxPC-3IC50=0.68 μM
    • Hemolytic Activity

      • Not available
    • Cytotoxicity

      • Not available
    • Binding Target

    • Not available
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Predicted Structure

    • There is no predicted structure for DRAMP32451.
    • Formula

    • Absent Amino Acids

    • Common Amino Acids

    • Mass

    • 0
    • PI

    • 0
    • Basic Residues

    • Acidic Residues

    • Hydrophobic Residues

    • Net Charge

    • Boman Index

    • 0
    • Hydrophobicity

    • 0
    • Aliphatic Index

    • 0
    • Half Life

      • Mammalian:
      • Yeast:
      • E.coli:
    • Extinction Coefficient Cystines

    • Absorbance 280nm

    • 0
    • Polar Residues

DRAMP32451

    • Not available

  • ·Literature 1
    • Title

    • Novel cyclotides from Hedyotis biflora inhibit proliferation and migration of pancreatic cancer cell in vitro and in vivo
    • Reference

    • Author