General Information

    • DRAMP ID

    • DRAMP32451

    • Peptide Name

    • B7

    • Source

    • Hedyotis biflora

    • Family

    • Gene

    • Not found

    • Sequence

    • GISCAETCVLLPCLSSVIGCTCQNKRCYKN

    • Sequence Length

    • 30

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Anticancer

    • Target Organism

      • Tumor cells:
        Target OrganismActivity
        MOH-1 (IC50=0.33 μM); PANC-1 (IC50=0.36 μM); Capan-2 (IC50=0.45 μM); BxPC-3IC50=0.68 μM

    • Hemolytic Activity

      • Not available

    • Cytotoxicity

      • Not available

    • Binding Target

    • Not available

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP32451 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP32451.

Physicochemical Information

    • Formula

    • C132H224N38O42S6

    • Absent Amino Acids

    • DFHMW

    • Common Amino Acids

    • C

    • Mass

    • 372529

    • PI

    • 8.11

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -2308

    • Hydrophobicity

    • 0.393

    • Aliphatic Index

    • 87.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 64.31

    • Polar Residues

    • 16

DRAMP32451

DRAMP32451 chydropathy plot

Comments Information

    • Not available

Literature Information

  • ·Literature 1

    • Title

    • Novel cyclotides from Hedyotis biflora inhibit proliferation and migration of pancreatic cancer cell in vitro and in vivo

    • Reference

    • Author