General Information

    • DRAMP ID

    • DRAMP35973

    • Peptide Name

    • Source

    • Synthetic

    • Family

    • Gene

    • Not found

    • Sequence

    • TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC

    • Sequence Length

    • 37

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Anticancer

    • Target Organism

      • Tumor cells: SNU449 (4.8% viability=162 μM); SNU449 (52.8% viability=71 μM)

    • Hemolytic Activity

      • Not available

    • Cytotoxicity

      • Not available

    • Binding Target

    • Not available

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP35973 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP35973.

Physicochemical Information

    • Formula

    • C180H302N52O55S4

    • Absent Amino Acids

    • DFHP

    • Common Amino Acids

    • K

    • Mass

    • 484526

    • PI

    • 9.47

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -6226

    • Hydrophobicity

    • -0.405

    • Aliphatic Index

    • 73.78

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 197.64

    • Polar Residues

    • 13

DRAMP35973

DRAMP35973 chydropathy plot

Comments Information

    • Not available

Literature Information

  • ·Literature 1

    • Title

    • Characterization of a novel peptide mined from the Red Sea brine pools and modified to enhance its anticancer activity

    • Reference

    • BMC Cancer. 2023 Jul 26;23(1):699.

    • Author

    • Abdou YT, Saleeb SM, Abdel-Raouf KMA, Allam M, Adel M, Amleh A.