General Information

    • DRAMP ID

    • DRAMP39397

    • Peptide Name

    • CA(1-24)M(1-13)

    • Source

    • Synthetic

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KWKLFKKIEKVGQNIRDGIIKAGPGIGAVLKVLTTGL

    • Sequence Length

    • 37

    • UniProt Entry

    • Protein Existence

    • Not found

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial,Antibacterial,Anti-Gram+,Anti-Gram-

    • Target Organism

      • [Ref.2689223]Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli K12(MIC=0.3µM);Pseudomonas aeruginosaMIC=1µM
      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtilis(MIC=0.5µM);Staphylococcus aureus(MIC=6µM);Streptococcus pyogenesMIC=2µM

    • Hemolytic Activity

      • [Ref.2689223]MIC>200µM for sheep red cells

    • Cytotoxicity

      • Not found

    • Binding Target

    • plasma membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Not found

    • Stereochemistry

    • L

    • Structure

    • Structure Description

    • Predicted Structure

    • There is no predicted structure for DRAMP39397.

Physicochemical Information

    • Formula

    • C186H318N50O46

    • Absent Amino Acids

    • Cys,His,Met,Ser,T

    • Common Amino Acids

    • Ala,Asp,G

    • Mass

    • 3990.82

    • PI

    • 10.39

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +6

    • Boman Index

    • 0

    • Hydrophobicity

    • 0.001

    • Aliphatic Index

    • 123.78

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 1.38

    • Polar Residues

    • 4

DRAMP39397

Comments Information

Literature Information

  • ·Literature 1

    • Title

    • Antibacterial and antimalarial properties of peptides that are cecropin-melittin hybrids.

    • Reference

    • FEBS Lett. 1989 Dec 18;259(1):103-6.

    • Author

    • Boman HG, Wade D, Boman IA, Wåhlin B, Merrifield RB.