• • DRAMP ID

  • DRAMP00069

• • Peptide Name

  • Garvieacin Q (GarQ; Bacteriocin)

• • Source

  • Lactococcus garvieae BCC 43578 (Gram-positive bacteria)

• • Family

  • Belongs to the class II bacteriocin

• • Gene

  • Not found

• • Sequence

  • EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH

• • Sequence Length

  • 50

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CC[C@H](N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)O)C(C)C)[C@@H](C)O)C(C)C)[C@@H](C)O)C(C)C)[C@@H](C)O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)O

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • Gram-positive bacteria:

      Target Organism	Activity
      Bacillus coagulans JCM 2257	-
      Listeria monocytogenes ATCC 19115	-
      L. garvieae strains	-
      E. faecium D48S52	-
      Lactobacillus plantarum BCC 9546	-
      Lactobacillus sakeii JCM 1157	-
      L. ivanovii DMST 9012	MIC=0.1-1.6 uM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.22210221] Purified GarQ, up to 1 mg/mL, was not cytotoxic to Vero (African green monkey kidney), HepG (human liver hepatocarcinoma) and Caco-2 (human colon adenocarcinoma) cell lines. Vero, HepG2 and Caco-2 have 94 ± 8, 97 ± 4 and 89 ± 7 % survival with indicated concentration (1mg/mL) of purified garvieacin Q compared to that of untreated control using the MTT assay.

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

• Predicted Structure

• There is no predicted structure for DRAMP00069.

DRAMP00069

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Garvieacin Q, a novel class II bacteriocin from Lactococcus garvieae BCC 43578.

• • Pubmed ID

  • 22210221

• • Reference

  • Appl Environ Microbiol. 2012 Mar;78(5):1619-1623.

• • Author

  • Tosukhowong A, Zendo T, Visessanguan W, Roytrakul S, Pumpuang L, Jaresitthikunchai J, Sonomoto K.