• DRAMP ID

    • DRAMP00105
    • Peptide Name

    • Enterocin X alpha (Two-peptide bacteriocin)
    • Source

    • Enterococcus faecium KU-B5 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • enxA
    • Sequence

    • SNDSLWYGVGQFMGKQANCITNHPVKHMIIPGYCLSKILG
    • Sequence Length

    • 40
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Enterococcus faecalis JCM 5803MIC=50.8 nM
        Enterococcus faecalis OU510MIC=102 nM
        Enterococcus faecium TUA 1344LMIC=50.8 nM
        Enterococcus hirae ATCC 10541MIC=50.8 nM
        Lactobacillus plantarum ATCC 14917MIC=102 nM
        Lactobacillus sakeii ssp.sakei JCM 1157MIC=50.8 nM
        Lactococcus lactis ssp.cremoris ATCC 19257MIC=813 nM
        Listeria innocua ATCC 33090MIC=25.4 nM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Stereochemistry

    • L
    • PDB ID

    • Predicted Structure

    • Formula

    • C198H307N53O54S4
    • Absent Amino Acids

    • ER
    • Common Amino Acids

    • G
    • Mass

    • 4422.18
    • PI

    • 8.77
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +4
    • Boman Index

    • -17.14
    • Hydrophobicity

    • 0.008
    • Aliphatic Index

    • 85.25
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8605
    • Absorbance 280nm

    • 220.64
    • Polar Residues

    • 16

DRAMP00105

DRAMP00105 chydropathy plot
    • Function

    • EntXalpha and EntXbeta encode a double-glycine-type prepeptide with an 18-residue leader sequence, representing the typical structure of class II bacteriocin prepeptides. When combined, Xalpha and Xbeta display variably enhanced or reduced antibacterial activity toward a panel of indicators compared to each peptide individually.
  • ·Literature 1
    • Title

    • Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.
    • Reference

    • Appl Environ Microbiol. 2010 Jul;76(13):4542-4545.
    • Author

    • Hu CB, Malaphan W, Zendo T, Nakayama J, Sonomoto K.