• DRAMP ID

    • DRAMP00165
    • Peptide Name

    • Gassericin A (GaaA; Bacteriocin)
    • Source

    • Lactobacillus gasseri LA39 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIc bacteriocin
    • Gene

    • gaaA
    • Sequence

    • IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWALAAAGALGATAA
    • Sequence Length

    • 58
    • Protein Existence

    • Predicted
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacterium:
        Target OrganismActivity
        L. reuteri LA6-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Alpha helix
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C261H411N67O72S
    • Absent Amino Acids

    • CEN
    • Common Amino Acids

    • A
    • Mass

    • 5671.6
    • PI

    • 6.75
    • Basic Residues

    • 3
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 35
    • Net Charge

    • +1
    • Boman Index

    • 47.31
    • Hydrophobicity

    • 0.997
    • Aliphatic Index

    • 116.72
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12490
    • Absorbance 280nm

    • 219.12
    • Polar Residues

    • 15

DRAMP00165

    • It causes K+ ion efflux from indicator cells and liposome.Circularized by forming a peptide bond between the N- and C-ends. Initially, it was thought to differ from Reutericin 6 only by the number of D-amino acids (Kawai et al., 2004). A re-study corrected this and concluded that gassericin A and reutericin 6 are identical bacteriocins (Arakawa et al. 2010 Lett Appl. Microbiol 50

    • 406-411). However, reutericin 6 was isolated from Lactobacillus reuteri LA6.
  • ·Literature 1
    • Title

    • Sequence analysis by cloning of the structural gene of gassericin A, a hydrophobic bacteriocin produced by Lactobacillus gasseri LA39.
    • Reference

    • Biosci Biotechnol Biochem. 1998 May;62(5):887-892.
    • Author

    • Kawai Y, Saito T, Suzuki M, Itoh T.
  • ·Literature 2
    • Title

    • Conjugative plasmid from Lactobacillus gasseri LA39 that carries genes for production of and immunity to the circular bacteriocin gassericin A.
    • Reference

    • Appl Environ Microbiol. 2009 Oct;75(19):6340-6351.
    • Author

    • Ito Y, Kawai Y, Arakawa K, Honme Y, Sasaki T, Saito T.