• DRAMP ID

    • DRAMP00166
    • Peptide Name

    • Butyrivibriocin AR10 (Bacteriocin)
    • Source

    • Butyrivibrium fibrisolvens AR10 (Gram-positive bacteria)
    • Family

    • Belongs to the class IIc bacteriocin
    • Gene

    • bviA
    • Sequence

    • IYFIADKMGIQLAPAWYQDIVNWVSAGGTLTTGFAIIVGVTVPAWIAEAAAAFGIASA
    • Sequence Length

    • 58
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Clostridium clostridiforme ATCC25537-
        C. perfringens-
        Eubacterium ruminentium ATCC17233-
        Lachnospira multiperus ATCC19207-
        L. vitulinus ATCC27783-
        Lactobacillus ruminis ATCC27780-
        Ruminococcus albus SY3-
        Streptococcus bovis ATCC33317-
        Listeria ivanovii 80-
        L. gray 83-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00166 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00166.
    • Formula

    • C284H427N65O76S
    • Absent Amino Acids

    • CHR
    • Common Amino Acids

    • A
    • Mass

    • 5999.96
    • PI

    • 4.03
    • Basic Residues

    • 1
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 34
    • Net Charge

    • -2
    • Boman Index

    • 51.97
    • Hydrophobicity

    • 1.002
    • Aliphatic Index

    • 114.66
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19480
    • Absorbance 280nm

    • 341.75
    • Polar Residues

    • 15

DRAMP00166

DRAMP00166 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Isolation and characterization of a bacteriocin (Butyrivibriocin AR10) from the ruminal anaerobe Butyrivibrio fibrisolvens AR10: evidence in support of the widespread occurrence of bacteriocin-like activity among ruminal isolates of B. fibrisolvens.
    • Reference

    • Appl Environ Microbiol. 1997 Feb;63(2):394-402.
    • Author

    • Kalmokoff ML, Teather RM.
  • ·Literature 2
    • Title

    • Butyrivibriocin AR10, a new cyclic bacteriocin produced by the ruminal anaerobe Butyrivibrio fibrisolvens AR10: characterization of the gene and peptide.
    • Reference

    • Can J Microbiol. 2003 Dec;49(12):763-773.
    • Author

    • Kalmokoff ML, Cyr TD, Hefford MA, Whitford MF, Teather RM.