• DRAMP ID

    • DRAMP00167
    • Peptide Name

    • Subtilosin A (Antilisterial bacteriocin subtilosin; D-amino acid; Bacteriocin; Preclinical)
    • Source

    • Bacillus subtilis (strain 168) (Gram-positive bacteria)
    • Family

    • Belongs to the class IIc bacteriocin
    • Gene

    • sboA
    • Sequence

    • NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
    • Sequence Length

    • 35
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • [Ref.17213266] MICs between 1 and 12.5 mg/L:
        Target OrganismActivity
        E. faecalis OGX-1-
        L. monocytogenes ATCC 19115-
        P. gingivalis ATCC 33277-
        K. rhizophila ATCC 9341-
        Enterobacter aerogenes ATCC 13408-
        Streptococcus pyogenes ATCC 19615 and Shigella sonnei ATCC 25931-
      • MICs between 25 and 100 mg/L:
        Target OrganismActivity
        Escherichia coli ATCC 8739-
        Pseudomonas aeruginosa ATCC 9027-
        S. gordonii Challis ATCC 49818 and Staphylococcus aureus ATCC 6538-
      • MICs over 100mg/L:
        Target OrganismActivity
        B. subtilis ATCC 6633-
        Fusobacterium nucleatum ATCC 25586-
        P. gingivalis W83-
        K. pneumoniae ATCC 4352-
        K. pneumoniae UMN1-
        Bacillus cereus ATCC 10876-
        Staphylococcus epidermidis ATCC 12228-
        Proteus mirabilis ATCC 25933-
        Salmonella enterica Typhi ATCC 12048-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • Thioether bridges between Cys4 and Phe31,Cys7 and Thr28,Cys13 and Phe22.
    • Stereochemistry

    • Mixed(D-Thr28,D-Phe31)
    • Structure

    • Alpha helix (1 helices; 6 residues)
    • Structure Description

    • The NMR study results demonstrate that in addition to having a cyclized peptide backbone (amide between N and C termini), three cross-links are formed between the sulfurs of Cys13, Cys7, and Cys4 and the alpha-positions of Phe22, Thr28, and Phe31, respectively.
    • PDB ID

    • 1PXQ resolved by NMR.
    • Predicted Structure

    • Formula

    • C152H234N38O46S3
    • Absent Amino Acids

    • HMQRY
    • Common Amino Acids

    • G
    • Mass

    • 3425.94
    • PI

    • 4.03
    • Basic Residues

    • 1
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 15
    • Net Charge

    • -2
    • Boman Index

    • 16.34
    • Hydrophobicity

    • 0.691
    • Aliphatic Index

    • 89.43
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 165.44
    • Polar Residues

    • 14

DRAMP00167

    • PTM

    • This peptide undergoes unique processing steps that include proteolytic cleavage after Glu-8, and covalent linkage of the alpha-amino of Asn-9 with the carboxyl of Gly-43 to form a cyclopeptide. Thioether cross-links are formed between cysteines and the alpha-carbons of other amino acids, Cys-12 to Phe-39, Cys- 15 to Thr-36, and Cys-21 to Phe-30. In forming these cross-links, Thr-36 and Phe-39 are converted to D-amino-acids. and 39 probably due to their modification, and reports a cyclic permutation of the peptide sequence.
  • ·Literature 1
    • Title

    • Subtilosin A, a new antibiotic peptide produced by Bacillus subtilis 168: isolation, structural analysis, and biogenesis.
    • Reference

    • J Biochem. 1985 Sep;98(3):585-603.
    • Author

    • Babasaki K, Takao T, Shimonishi Y, Kurahashi K.
  • ·Literature 2
    • Title

    • Structure of subtilosin A, a cyclic antimicrobial peptide from Bacillus subtilis with unusual sulfur to alpha-carbon cross-links: formation and reduction of alpha-thio-alpha-amino acid derivatives.
    • Reference

    • Biochemistry. 2004 Mar 30;43(12):3385-3395.
    • Author

    • Kawulka KE, Sprules T, Diaper CM, Whittal RM, McKay RT, Mercier P, Zuber P, Vederas JC.