General Information

    • DRAMP ID

    • DRAMP00172

    • Peptide Name

    • Garvicin ML (Bacteriocin)

    • Source

    • Lactococcus garvieae DCC43 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • garML

    • Sequence

    • LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA

    • Sequence Length

    • 60

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Lactobacillus reuteri 20016378
        L. helveticus 15009492
        L. curvatus 2739177
        L. casei 3341-174
        L. acidophilus 4356236
        L. sakei 27141-445
        Lactococcus lactis BB24928
        L. lactis NZ9000163
        L. lactis DPC5598 (1-541)，L. garvieae 5274617
        L. garvieae 58062-807
        L. garvieae 58072-705
        L. raffinolactis 988228
        Pediococcus acidilactici 3471-398
        P. pentosaceus FBB611-131
        Enterococcus faecium P131-291
        E. faecium L50719
        E. faecialis DBH1825
        E. faecalis P4123
        Propionibacterium sp.P6190
        P. acidipropionici 563864
        Clostridium tyrobutiricum 3.5CT651
        C. tyrobutiricum 1754839
        C. perfringens 376352
        C. botulinum 551574
        Listeria monocytogenes 4032662
        L. ivanovii 9131-020
        L. seeligeri 917684
        L. grayi 931742
        L. welshimeri 919452
        Brochothrix thermosphacta 847283
        Streptococcus pneumoniae FQ26590
        S. pneumoniae 67620596
        S. pneumoniae 15M-1047790

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00172 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00172.

Physicochemical Information

    • Formula

    • C275H458N70O74S3

    • Absent Amino Acids

    • CEHPR

    • Common Amino Acids

    • A

    • Mass

    • 6025.27

    • PI

    • 10.13

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 33

    • Net Charge

    • +5

    • Boman Index

    • 38.05

    • Hydrophobicity

    • 0.887

    • Aliphatic Index

    • 115.83

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 118.47

    • Polar Residues

    • 15

DRAMP00172

DRAMP00172 chydropathy plot

Comments Information

    • The peptide is expressed as a 63mer precursor. The leader sequence was removed and covalent link of the N and C-termini leading to the mature peptide. This bacteriocin inhibits other Gram-positive bacteria. The cyclic structure of the peptide confers stability to heat (80-100oC), pH (2-10) and proteases (trypsin, pepsin, papain and proteinase K).

Literature Information

  • ·Literature 1

    • Title

    • Characterization of Garvicin ML, a Novel Circular Bacteriocin Produced by Lactococcus garvieae DCC43, Isolated from Mallard Ducks (Anas platyrhynchos).

    • Reference

    • Appl Environ Microbiol. 2011 Jan;77(1):369-373.

    • Author

    • Borrero J, Brede DA, Skaugen M, Diep DB, Herranz C, Nes IF, Cintas LM, Hern¡ndez PE.