• DRAMP ID

    • DRAMP00175
    • Peptide Name

    • Enterocin L50A (EntL50A; Bacteriocin)
    • Source

    • Enterococcus faecium E980/L50 (Gram-positive bacteria)
    • Family

    • Belongs to the class IId bacteriocin
    • Gene

    • Not found
    • Sequence

    • MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIEWIKKHI
    • Sequence Length

    • 44
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • [Ref.9555877]Gram-positive bacteria:
        Target OrganismActivity
        Pediococcus acidilactici 3472400AU/ml
        Enterococcus faecium T1361200AU/ml
        Lactococcus lactis subsp.cremoris CNRZ 1774800AU/ml
        Lactobacillus sake 148600AU/ml
    • Hemolytic Activity

      • [Ref:9555877]Non-hemolytic activity
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00175 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00175.
    • Formula

    • C252H392N60O54S2
    • Absent Amino Acids

    • CDRST
    • Common Amino Acids

    • I
    • Mass

    • 5190.37
    • PI

    • 10
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 21
    • Net Charge

    • +7
    • Boman Index

    • 5.25
    • Hydrophobicity

    • 0.202
    • Aliphatic Index

    • 110.91
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19480
    • Absorbance 280nm

    • 453.02
    • Polar Residues

    • 7

DRAMP00175

DRAMP00175 chydropathy plot
    • Function

    • Expression in vivo and in vitro transcription/translation experiments demonstrated that entL50A and entL50B are the only genes required to obtain antimicrobial activity, strongly indicating that their bacteriocin products are not posttranslationally modified. Both bacteriocins possess antimicrobial activity on their own, with EntL50A being the most active. In addition, when the two bacteriocins were combined, a considerable synergism was observed, especially with some indicator strains. Non-hemolytic activity
  • ·Literature 1
    • Title

    • Enterocins L50A and L50B, two novel bacteriocins from Enterococcus faecium L50, are related to staphylococcal hemolysins.
    • Reference

    • Bacteriol. 1998 Apr;180(8):1988-1994.
    • Author

    • Cintas LM, Casaus P, Holo H, Hernandez PE, Nes IF, H¥varstein LS.
  • ·Literature 2
    • Title

    • Pyrosequencing-based comparative genome analysis of the nosocomial pathogen Enterococcus faecium and identification of a large transferable pathogenicity island.
    • Reference

    • BMC Genomics. 2010 Apr 14;11:239.
    • Author

    • van Schaik W, Top J, Riley DR, Boekhorst J, Vrijenhoek JE, Schapendonk CM, Hendrickx AP, Nijman IJ, Bonten MJ, Tettelin H, Willems RJ.