• DRAMP ID

    • DRAMP00178
    • Peptide Name

    • Enterocin EJ97 (EntEJ97; Bacteriocin)
    • Source

    • Enterococcus faecalis EJ97 (Gram-positive bacteria)
    • Family

    • Belongs to the class IId bacteriocin
    • Gene

    • ej97a
    • Sequence

    • MLAKIKAMIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA
    • Sequence Length

    • 44
    • Protein Existence

    • Predicted
    • SMILES

    • CC[C@@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)N[C@H](C(=O)O)C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)O)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)[C@H](C)CC)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@H](C)CC
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus circulansMIC=12 µg/ml
        Bacillus coagulans CECT 12MIC=2 µg/ml
        Bacillus megateriumMIC=4 µg/ml
        Bacillus stearothermophilus CECT 49MIC=14 µg/ml
        Bacillus stearothermophilus CECT 148MIC=12 µg/ml
        Bacillus subtilisMIC=12 µg/ml
        Paenibacillus macerans CECT 19MIC=4 µg/ml
        Enterococcus faecalis ssp.faecalis S-13MIC=6 µg/ml
        E. faecalis ssp.faecalis S-14MIC=8 µg/ml
        E. faecalis ssp.faecalis S-32MIC=12 µg/ml
        E. faecalis ssp.faecalis S-86MIC=8 µg/ml
        E. faecalis ssp.liquefaciens S-39MIC=6 µg/ml
        E. faecalis ssp.liquefaciens S-40MIC=8 µg/ml
        E. faecalis ssp. liquefaciens S-47MIC=12 µg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C252H384N62O61S2
    • Absent Amino Acids

    • CDHS
    • Common Amino Acids

    • K
    • Mass

    • 5322.32
    • PI

    • 9.92
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +6
    • Boman Index

    • -53.64
    • Hydrophobicity

    • -0.589
    • Aliphatic Index

    • 71.14
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18450
    • Absorbance 280nm

    • 429.07
    • Polar Residues

    • 11

DRAMP00178

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • The genes coding for enterocin EJ97 production by Enterococcus faecalis EJ97 are located on a conjugative plasmid.
    • Reference

    • Appl Environ Microbiol. 2003 Mar;69(3):1633-1641.
    • Author

    • S¡nchez-Hidalgo M, Maqueda M, G¡lvez A, Abriouel H, Valdivia E, Mart­nez-Bueno M.
  • ·Literature 2
    • Title

    • Structural characterisation of the natively unfolded enterocin EJ97.
    • Reference

    • Protein Eng Des Sel. 2010 Jul;23(7):507-518.
    • Author

    • Neira JL, Contreras LM, de los Pa±os OR, S¡nchez-Hidalgo M, Mart­nez-Bueno M, Maqueda M, Rico M.
  • ·Literature 3
    • Title

    • Isolation and characterization of enterocin EJ97, a bacteriocin produced by Enterococcus faecalis EJ97.
    • Reference

    • Arch Microbiol. 1998 Dec;171(1):59-65.
    • Author

    • G¡lvez A, Valdivia E, Abriouel H, Camafeita E, Mendez E, Mart­nez-Bueno M, Maqueda M.