General Information

    • DRAMP ID

    • DRAMP00196

    • Peptide Name

    • Microcin L (MccL; Bacteriocin)

    • Source

    • Escherichia coli (Gram-negative bacteria)

    • Family

    • Belongs to the class IIa microcin

    • Gene

    • mclC

    • Sequence

    • GDVNWVDVGKTVATNGAGVIGGAFGAGLCGPVCAGAFAVGSSAAVAALYDAAGNSNSAKQKPEGLPPEAWNYAEGRMCNWSPNNLSDVCL

    • Sequence Length

    • 90

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli-
        Klebsiella oxytoca CIP666-
        Salmonella enterica serovar Agon-
        S. enterica serovar Braenderup-
        S. enterica serovar Brandenburg-
        S. enterica serovar Bredeney-
        S. enterica serovar Derby-
        S. enterica serovar Dublin-
        S. enterica serovar Enteritidis ATCC 13076-
        S. enterica serovar Hadar-
        S. enterica serovar Heildeberg-
        S. enterica serovar Indiana-
        S. enterica serovar Kottbus-
        S. enterica serovar Newport-
        S. enterica serovar St.Paul-
        S. enterica serovar Typhimurium CIP5858-
        S. enterica serovar Virchow-
        Shigella sonnei CIP5236-
        Shigella flexneri CIP5236-
        Pseudomonas aeruginosa CIP100720T-
        Pseudomonas aeruginosa ATCC 27853-

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00196 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00196.

Physicochemical Information

    • Formula

    • C386H590N108O124S5

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • A

    • Mass

    • 8887.88

    • PI

    • 4.39

    • Basic Residues

    • 4

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 36

    • Net Charge

    • -3

    • Boman Index

    • -42.94

    • Hydrophobicity

    • 0.114

    • Aliphatic Index

    • 72.78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19730

    • Absorbance 280nm

    • 221.69

    • Polar Residues

    • 36

DRAMP00196

DRAMP00196 chydropathy plot

Comments Information

    • It targets bacterial membranes and induces ion channel formation, leading to the disruption of the proton-motive force and hence ATP production.

Literature Information

  • ·Literature 1

    • Title

    • Genetic analysis and complete primary structure of microcin L.

    • Reference

    • Antimicrob Agents Chemother. 2004 Feb;48(2):505-513.

    • Author

    • Pons AM, Delalande F, Duarte M, Benoit S, Lanneluc I, Sabl© S, Van Dorsselaer A, Cottenceau G.
  • ·Literature 2

    • Title

    • Wild-type Escherichia coli producing microcins B17, D93, J25, and L; cloning of genes for microcin L production and immunity.

    • Reference

    • Can J Microbiol. 2003 May;49(5):357-361.

    • Author

    • Sabl© S, Duarte M, Bravo D, Lanneluc I, Pons AM, Cottenceau G, Moreno F.