• DRAMP ID

    • DRAMP00436
    • Peptide Name

    • Pisum sativum defensin 1 (Psd1; Plant defensin)
    • Source

    • Pisum sativum (Garden pea)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC
    • Sequence Length

    • 46
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • PD:
        Target OrganismActivity
        Aspergillus nigerMIC=12.1 µg/ml
        Aspergillus versicolorMIC<5.0 µg/ml
        Fusarium moniliformeMIC=21.7 µg/ml
        Fusarium oxysporumMIC>100 µg/ml
        Fusarium solaniMIC=12.1 µg/ml
        Neurospora crassaMIC=0.04 µg/ml
        Saccharomyces cerevisaeMIC>100 µg/ml
        Trichophyton mentagrophytesMIC>100 µg/ml
      • PD+:
        Target OrganismActivity
        Aspergillus nigerMIC=7.4 µg/ml
        Fusarium moniliformeMIC=33.2 µg/ml
        Fusarium oxysporumMIC=100 µg/ml
        Fusarium solaniMIC=79.2 µg/ml
        Neurospora crassaMIC=0.05 µg/ml
      • NOTE:
        Target OrganismActivity
        PD+: potato dextrose medium supplemented with 1 mM CaCl2-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • It interacts with cell-cycle-realted protein cyclin F as the target.
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization of a C-terminal Cys residue (forming a disulfide bond)
    • Nonterminal Modifications and Unusual Amino Acids

    • There are four disulfide bonds between Cys3 and Cys46, Cys14 and Cys35, Cys20 and Cys40, Cys24 and Cys42
    • Stereochemistry

    • L
    • PDB ID

    • 1JKZ resolved by NMR.
    • Predicted Structure

    • Formula

    • C216H329N67O68S8
    • Absent Amino Acids

    • MP
    • Common Amino Acids

    • C
    • Mass

    • 5208.88
    • PI

    • 7.73
    • Basic Residues

    • 9
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +5
    • Boman Index

    • -95.98
    • Hydrophobicity

    • -0.548
    • Aliphatic Index

    • 38.26
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7490
    • Absorbance 280nm

    • 166.44
    • Polar Residues

    • 22

DRAMP00436

DRAMP00436 chydropathy plot
    • PTM

    • Contains four disulfide bonds 3-46; 14-35; 20-40; 24-42.
  • ·Literature 1
    • Title

    • Characterization of two novel defense peptides from pea (Pisum sativum) seeds.
    • Reference

    • Arch Biochem Biophys. 2000 Jun 15;378(2):278-286.
    • Author

    • Almeida M.S, Cabral K.M, Zingali R.B, Kurtenbach E.
  • ·Literature 2
    • Title

    • cDNA cloning and heterologous expression of functional cysteine-rich antifungal protein Psd1 in the yeast Pichia pastoris.
    • Reference

    • Arch Biochem Biophys. 2001 Nov 15;395(2):199-207.
    • Author

    • Almeida MS, Cabral KS, de Medeiros LN, Valente AP, Almeida FC, Kurtenbach E.
  • ·Literature 3
    • Title

    • Solution structure of Pisum sativum defensin 1 by high resolution NMR: plant defensins, identical backbone with different mechanisms of action.
    • Reference

    • J Mol Biol. 2002 Jan 25;315(4):749-757.
    • Author

    • Almeida MS, Cabral KM, Kurtenbach E, Almeida FC, Valente AP.