• DRAMP ID

    • DRAMP00840
    • Peptide Name

    • Cyclotide cter-B (Plant defensin)
    • Source

    • Clitoria ternatea (Butterfly pea)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GVPCAESCVWIPCTVTALLGCSCKDKVCYLN
    • Sequence Length

    • 31
    • Protein Existence

    • Protein level
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C141H227N35O42S6
    • Absent Amino Acids

    • FHMQR
    • Common Amino Acids

    • C
    • Mass

    • 3276.92
    • PI

    • 6.03
    • Basic Residues

    • 2
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 11
    • Net Charge

    • 0
    • Boman Index

    • 6
    • Hydrophobicity

    • 0.768
    • Aliphatic Index

    • 94.19
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 245.5
    • Polar Residues

    • 14

DRAMP00840

DRAMP00840 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism.
    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-21; 8-23; 13-28.
  • ·Literature 1
    • Title

    • Discovery of cyclotides in the fabaceae plant family provides new insights into the cyclization, evolution, and distribution of circular proteins.
    • Reference

    • ACS Chem Biol. 2011 Apr 15;6(4):345-355.
    • Author

    • Poth AG, Colgrave ML, Philip R, Kerenga B, Daly NL, Anderson MA, Craik DJ.