• DRAMP ID

    • DRAMP18195
    • Peptide Name

    • LsbB (Bacteriocin)
    • Source

    • Lactococcus lactis subsp. lactis (Streptococcus lactis)
    • Family

    • Not found
    • Gene

    • lsbB
    • Sequence

    • MKTILRFVAGYDIASHKKKTGGYPWERGKA
    • Sequence Length

    • 30
    • Protein Existence

    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • targeting primarily lactococcal cells
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Predicted Structure

    • Formula

    • C156H246N44O40S
    • Absent Amino Acids

    • CNQ
    • Common Amino Acids

    • K
    • Mass

    • 3410
    • PI

    • 10.12
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +6
    • Boman Index

    • -5095
    • Hydrophobicity

    • -0.683
    • Aliphatic Index

    • 58.67
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 292.41
    • Polar Residues

    • 9

DRAMP18195

    • The results indicate that the outmost eight-amino acid sequence at the C-terminal end is likely to contain the receptor binding domain. Alanine substitution revealed that the tryptophan in position 25 (Trp25) is crucial for the blocking activity of the truncated peptides, as well as for the antimicrobial activity of the full-length bacteriocin. 

  • ·Literature 1
    • Title

    • Novel mechanism of bacteriocin secretion and immunity carried out bylactococcal multidrug resistance proteins.
    • Reference

    • J. Biol. Chem. 278:34291-34298(2003).
    • Author

    • Gajic O., Buist G., Kojic M., Topisirovic L., Kuipers O.P., Kok J.
  • ·Literature 2
    • Title

    • Defining the structure and receptor binding domain of the leaderlessbacteriocin LsbB.
    • Reference

    • J. Biol. Chem. 289:23838-23845(2014)
    • Author

    • Ovchinnikov K.V., Kristiansen P.E., Uzelac G., Topisirovic L.,Kojic M., Nissen-Meyer J., Nes I.F., Diep D.B.