General Information

    • DRAMP ID

    • DRAMP18212

    • Peptide Name

    • Amylocyclicin(Bacteriocin)

    • Source

    • Bacillus amyloliquefaciens FZB42

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • acnA

    • Sequence

    • LASTLGISTAAAKKAIDIIDAASTIASIISLIGIVTGAGAISYAIVATAKTMIKKYGKKYAAAW

    • Sequence Length

    • 64

    • UniProt Entry

    • No entry found

    • Protein Existence

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Most similar to circular Uberolysin (45.9%).

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C293H492N72O84S

    • Absent Amino Acids

    • CEFHNPQR

    • Common Amino Acids

    • A

    • Mass

    • 6399.62

    • PI

    • 9.82

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 34

    • Net Charge

    • +5

    • Boman Index

    • 2769

    • Hydrophobicity

    • 0.85

    • Aliphatic Index

    • 125.47

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 158.25

    • Polar Residues

    • 20

DRAMP18212

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Amylocyclicin, a Novel Circular Bacteriocin Produced by Bacillus amyloliquefaciens FZB42.

    • Reference

    • J Bacteriol. 2014 May;196(10):1842-52.

    • Author

    • Scholz R, Vater J, Budiharjo A, Wang Z, He Y, Dietel K, Schwecke T, Herfort S, Lasch P, Borriss R.