General Information

    • DRAMP ID

    • DRAMP18241

    • Peptide Name

    • Subtilomycin(Bacteriocin)

    • Source

    • Bacillus subtilis MMA7

    • Family

    • Belongs to the lantibiotics family (Class I bacteriocin)

    • Gene

    • subA

    • Sequence

    • TWATIGKTIVQSVKKCRTFTCGCSLGSCSNCN

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

    • Gram-positive, Gram-negative (broad spectrum)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • There are extensive post-translational modifications: T1, T4 and T8 are dehydrated into Dhb. The N-terminal Dhb was unstable and further oxidized by deamination into 2-oxo butyrate. In addition, thioether or methylthioether bonds occur between the following residue pairs: S11-C15, T17-C21, T20-C23, S24-C28, and S27-C31.

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C141H234N42O45S5

    • Absent Amino Acids

    • DEHMPY

    • Common Amino Acids

    • CT

    • Mass

    • 3397.96

    • PI

    • 9.07

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -3766

    • Hydrophobicity

    • 0.088

    • Aliphatic Index

    • 57.81

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 185.48

    • Polar Residues

    • 19

DRAMP18241

Comments Information

    • Therefore the most likely sequence for the lantibiotic is Dhb*-W-A-Dhb-I-G-K-Dhb-I-V-Q-Dha-V-K-K-C-R-Dhb-F-Dhb-C-G-C-Dha-L-G-Dha-C-Dha-N-C-N, where the underlined amino acids have been experimentally confirmed by mass spectrometric analysis and the subsequent sequence predicted from the genomic sequence of strain MMA7.

Literature Information

  • ·Literature 1

    • Title

    • Subtilomycin: a new lantibiotic from Bacillus subtilis strain MMA7 isolated from the marine sponge Haliclona simulans.

    • Reference

    • Mar Drugs. 2013 Jun 3;11(6):1878-98.

    • Author

    • Phelan RW, Barret M, Cotter PD, O'Connor PM, Chen R, Morrissey JP, Dobson AD, O'Gara F, Barbosa TM.