General Information

    • DRAMP ID

    • DRAMP18244

    • Peptide Name

    • Ticin A3(Bacteriocin)

    • Source

    • Bacillus thuringiensis BMB3201

    • Family

    • Belongs to the lantibiotics family (Class I bacteriocin)

    • Gene

    • Not found

    • Sequence

    • SLGVTLGAAGVYTATQTIATQIWKCGAVLTTSAECSRTGNSC

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C177H292N50O61S3

    • Absent Amino Acids

    • DFHMP

    • Common Amino Acids

    • T

    • Mass

    • 4192.74

    • PI

    • 7.69

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +1

    • Boman Index

    • -2085

    • Hydrophobicity

    • 0.379

    • Aliphatic Index

    • 81.43

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 173.54

    • Polar Residues

    • 22

DRAMP18244

Comments Information

    • Activity spectrum is similar to Ticin A4. Chemical modifications such as dehydration are to be determined. Chemical modifications such as dehydration are to be determined.

Literature Information

  • ·Literature 1

    • Title

    • Three Novel Lantibiotics, Ticins A1, A3, and A4, Have Extremely Stable Properties and Are Promising Food Biopreservatives.

    • Reference

    • Appl Environ Microbiol. 2015 Oct;81(20):6964-72.

    • Author

    • Xin B, Zheng J, Xu Z, Li C, Ruan L, Peng D, Sun M.