General Information

    • DRAMP ID

    • DRAMP18245

    • Peptide Name

    • Ticin A4(Bacteriocin)

    • Source

    • Bacillus thuringiensis BMB3201

    • Family

    • Belongs to the lantibiotics family (Class I bacteriocin)

    • Gene

    • Not found

    • Sequence

    • SLGVTLGAAGVYTATQTIATQIWKCGAVLTTSAECSRTGKSC

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C179H298N50O60S3

    • Absent Amino Acids

    • DFHMNP

    • Common Amino Acids

    • T

    • Mass

    • 4206.81

    • PI

    • 8.63

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +2

    • Boman Index

    • -1976

    • Hydrophobicity

    • 0.369

    • Aliphatic Index

    • 81.43

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 173.54

    • Polar Residues

    • 21

DRAMP18245

Comments Information

    • Comment

    • Active against the tested Gram-positive bacteria, including B. amyloliquefaciens, B. cereus, B. firmus, B. thuringiensis, B. subtilis, B. pumilus, E. faecalis, L. monocytogenes, Microbacterium, Paenibacillus, S. aureus, and S. sciuri. However, they are more active against food-borne pathogens such as B. cereus and L. monocytogenes. Chemical modifications such as dehydration are to be determined.

Literature Information

  • ·Literature 1

    • Title

    • Three Novel Lantibiotics, Ticins A1, A3, and A4, Have Extremely Stable Properties and Are Promising Food Biopreservatives.

    • Reference

    • Appl Environ Microbiol. 2015 Oct;81(20):6964-72.

    • Author

    • Xin B, Zheng J, Xu Z, Li C, Ruan L, Peng D, Sun M.