General Information

    • DRAMP ID

    • DRAMP18256

    • Peptide Name

    • Boticin B (Bacteriocin)

    • Source

    • Clostridium botulinum

    • Family

    • Not found

    • Gene

    • btcB

    • Sequence

    • GLCAVNEFVALAAIPGGAATFAVCQMPNLDEIVSNAAYV

    • Sequence Length

    • 39

    • Protein Existence

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Boticin B appears to be unique since it shows no detectable homology to other bacteriocins, including those from clostridial species.

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C174H273N43O53S3

    • Absent Amino Acids

    • HKRW

    • Common Amino Acids

    • A

    • Mass

    • 3911.52

    • PI

    • 3.57

    • Basic Residues

    • 0

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 21

    • Net Charge

    • -3

    • Boman Index

    • 2087

    • Hydrophobicity

    • 0.985

    • Aliphatic Index

    • 110.26

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 42.5

    • Polar Residues

    • 11

DRAMP18256

Comments Information

    • Amino acid analysis of purified boticin B estimated that the active protein contained 39 amino acids. Boticin B is a heat-stable bacteriocin produced by Clostridium botulinum strain 213B that has inhibitory activity against various strains of C. botulinum and related clostridia.

Literature Information

  • ·Literature 1

    • Title

    • Cloning, nucleotide sequence, and expression of the gene encoding the bacteriocin boticin B from Clostridium botulinum strain 213B.

    • Reference

    • Appl Environ Microbiol. 2000 Dec;66(12):5480-3.

    • Author

    • Dineen SS, Bradshaw M, Johnson EA.