General Information

    • DRAMP ID

    • DRAMP18258

    • Peptide Name

    • Closticin 574(Bacteriocin)

    • Source

    • Clostridium tyrobutyricum ADRIAT 932

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • cloA

    • Sequence

    • PNWTKIGKCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQKAAKLLVGATTWEEKLHAGGYALINLAAELTGVAGIQANCF

    • Sequence Length

    • 82

    • Protein Existence

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(narrow)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C390H625N101O104S2

    • Absent Amino Acids

    • DMR

    • Common Amino Acids

    • AG

    • Mass

    • 8456.99

    • PI

    • 9.48

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 39

    • Net Charge

    • +6

    • Boman Index

    • 1950

    • Hydrophobicity

    • 0.389

    • Aliphatic Index

    • 109.76

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 19605

    • Absorbance 280nm

    • 242.04

    • Polar Residues

    • 26

DRAMP18258

Comments Information

    • Closticin 574 is, on the basis of the nucleotide sequence of its structural gene, produced as preproprotein of 309 amino acid residues. After secretion and processing, it gives rise to an antimicrobial peptide of 82 amino acid residues.

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of two novel clostridial bacteriocins, circularin A and closticin 574.

    • Reference

    • Appl Environ Microbiol. 2003 Mar;69(3):1589-97.

    • Author

    • Kemperman R, Kuipers A, Karsens H, Nauta A, Kuipers O, Kok J.