General Information

    • DRAMP ID

    • DRAMP18259

    • Peptide Name

    • Enterocin O16 (Bacteriocin)

    • Source

    • Enterococcus faecalis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LGSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCGLS

    • Sequence Length

    • 68

    • UniProt Entry

    • No entry found

    • Protein Existence

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(certain)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C330H545N87O87S3

    • Absent Amino Acids

    • HPY

    • Common Amino Acids

    • A

    • Mass

    • 7219.67

    • PI

    • 9.84

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 37

    • Net Charge

    • +6

    • Boman Index

    • -294

    • Hydrophobicity

    • 0.622

    • Aliphatic Index

    • 119.26

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 11125

    • Absorbance 280nm

    • 166.04

    • Polar Residues

    • 15

DRAMP18259

Comments Information

    • the enterocin O16 antimicrobial peptide is translated as a large precursor pre-proprotein. The precursor is secreted via the general secretory pathway, and a 30-residues proprotein is released from the cells

Literature Information

  • ·Literature 1

    • Title

    • The fsr Quorum-Sensing System and Cognate Gelatinase Orchestrate the Expression and Processing of Proprotein EF_1097 into the Mature Antimicrobial Peptide Enterocin O16.

    • Reference

    • J Bacteriol. 2015 Jul;197(13):2112-21.

    • Author

    • Dundar H, Brede DA, La Rosa SL, El-Gendy AO, Diep DB, Nes IF.