• DRAMP ID

    • DRAMP39397
    • Peptide Name

    • CA(1-24)M(1-13)
    • Source

    • Synthetic
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • KWKLFKKIEKVGQNIRDGIIKAGPGIGAVLKVLTTGL
    • Sequence Length

    • 37
    • Protein Existence

    • Not found
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial,Antibacterial,Anti-Gram+,Anti-Gram-
    • Target Organism

      • [Ref.2689223]Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli K12(MIC=0.3µM);Pseudomonas aeruginosaMIC=1µM
      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtilis(MIC=0.5µM);Staphylococcus aureus(MIC=6µM);Streptococcus pyogenesMIC=2µM
    • Hemolytic Activity

      • [Ref.2689223]MIC>200µM for sheep red cells
    • Cytotoxicity

      • Not found
    • Binding Target

    • plasma membrane
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Not found
    • Stereochemistry

    • L
    • Structure

    • Structure Description

    • Predicted Structure

    • Formula

    • C186H318N50O46
    • Absent Amino Acids

    • Cys,His,Met,Ser,T
    • Common Amino Acids

    • Ala,Asp,G
    • Mass

    • 3990.82
    • PI

    • 10.39
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +6
    • Boman Index

    • 0
    • Hydrophobicity

    • 0.001
    • Aliphatic Index

    • 123.78
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 1.38
    • Polar Residues

    • 4

DRAMP39397

  • ·Literature 1
    • Title

    • Antibacterial and antimalarial properties of peptides that are cecropin-melittin hybrids.
    • Reference

    • FEBS Lett. 1989 Dec 18;259(1):103-6.
    • Author

    • Boman HG, Wade D, Boman IA, Wåhlin B, Merrifield RB.