General Information

    • DRAMP ID

    • DRAMP29909

    • Peptide Name

    • RMP-16 (Recombinant slow-release TNF α-derived peptide)

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MWQRPSSWIEGRLLTHTISRIAVSYQTKVNLL

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

    • SMILES

    • CC[C@@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)O)[C@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)O)C(C)C)[C@@H](C)O)C(C)C)[C@H](C)CC)[C@@H](C)O)[C@@H](C)O

Activity Information

    • Biological Activity

    • Anti-cancer

    • Target Organism

    • Not available

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Stability Information

    • Serum or Protease Type

    • Rat plasma

    • Stability Data

    • The half-life is 15.83h.

    • Assay

    • LC/MS

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • Predicted Structure

    • There is no predicted structure for DRAMP29909.

Literature Information

  • ·Literature 1

    • Title

    • A novel recombinant slow-release TNF α-derived peptide effectively inhibits tumor growth and angiogensis.

    • Reference

    • Sci Rep. 2015 Sep 4;5:13595.

    • Author

    • Ma Y, Zhao S, Shen S, Fang S, Ye Z, Shi Z, Hong A