-
-
Sequence
- TLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
-
-
Sequence Name
- Sequence 3 from Patent US 20020115602
-
Source
- Synthetic construct
-
SMILES
-
CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)[C@@H](C)O)C(C)C)C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2002-8-22
-
-
Patent Title
- Human beta-defensin-3 (HBD-3), a highly cationic beta-defensin antimicrobial peptide.
-
Abstract
- The present invention relates a novel antimicrobial peptide HBD-3 and derivatives thereof as well as the gene encoding the peptide. The invention further relates to methods of use of the HBD-3 peptide including a method of inhibiting microbial growth by administering an effective amount of the HBD-3 peptide alone or in combinination with other antimicrobial agents or antibiotics. In addition, the immunomodulatory properties of the HBD-3 peptide also facilitate the manipulation of the immune response, i.e., as a chemoattractant for immature dentritic cells or memory T cells.
