DRAMP
  1. Home
  2. Browse
  3. Anticancer Data
Result: 201 - 220 of 281
<< First
< Prev
9
10
11
12
13
14
15
Next >
Last >>
DRAMP IDPeptide NAMEPeptide SequenceSourceBiological ActivityPubmed ID
DRAMP17239Sequence 3 from Patent US 20050239703ELKCYTCKEPMTSAACRTITSynthetic constructAnticancerUS 2005/0239703 A1
DRAMP17240Sequence 1 from Patent US 20060100147YLCAGRNDCIIAIKFEEKTAQHAAIENVFRLESynthetic constructAnticancerUS 2006/0100147 A1
DRAMP17283Sequence 1 from Patent US 20100279918CREKASynthetic constructAnticancerUS 2010/0279918 A1
DRAMP17284Sequence 2 from Patent US 20100279918CPGPEGAGCSynthetic constructAnticancerUS 2010/0279918 A1
DRAMP17285Sequence 4 from Patent US 20100279918GRKKRRQRRRPPQHuman immunodeficiency viAnticancerUS 2010/0279918 A1
DRAMP17286Sequence 5 from Patent US 20100279918DAATATRGRSAASRPTERPRAPARSASRPRRVDHerpes simplex virus typeAnticancerUS 2010/0279918 A1
DRAMP17287Sequence 6 from Patent US 20100279918LLIILRRRIRKQAHAHSKMurinae gen. sp.AnticancerUS 2010/0279918 A1
DRAMP17288Sequence 7 from Patent US 20100279918RVIRVWFQNKRCKDKKRattus sp.AnticancerUS 2010/0279918 A1
DRAMP17289Sequence 8 from Patent US 20100279918LGTYTQDFNKFHTFPQTAIGVGAPHomo sapiensAnticancerUS 2010/0279918 A1
DRAMP17290Sequence 9 from Patent US 20100279918 (Deleted)LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESHomo sapiensAnticancer
DRAMP17291Sequence 10 from Patent US 20100279918MANLGYWLLALFVTMWTDVGLCKKRPKPMus sp.AnticancerUS 2010/0279918 A1
DRAMP17292Sequence 11 from Patent US 20100279918 (Deleted)GWTLNSAGYLLGKINLKALAALAKKILSynthetic constructAnticancer
DRAMP17293Sequence 12 from Patent US 20100279918AGYLLGKINLKALAALAKKILSynthetic constructAnticancerUS 2010/0279918 A1
DRAMP17294Sequence 13 from Patent US 20100279918 (Deleted)RRRRRRRRRRRSynthetic constructAnticancer
DRAMP17295Sequence 16 from Patent US 20100279918KETWFETWFTEWSQPKKKRKVSynthetic constructAnticancerUS 2010/0279918 A1
DRAMP17296Sequence 17 from Patent US 20100279918GALFLGWLGAAGSTMGAPKKKRKVSynthetic constructAnticancerUS 2010/0279918 A1
DRAMP17297Sequence 18 from Patent US 20100279918WEAKLAKALAKALAKHLAKALAKALKACEASynthetic constructAnticancerUS 2010/0279918 A1
DRAMP17298Sequence 19 from Patent US 20100279918GLFKALLKLLKSLWKLLLKASynthetic constructAnticancerUS 2010/0279918 A1
DRAMP18151Glutoxim(NOV-002)Not availableGlutathione Disulfide NOV-002 is a stabilized formulation of disodium glutathione disulfide (GSSG; oxidized glutathione) and cisplatin (1000:1) with pAnticancer12087719
DRAMP18084Talactoferrin alpha(Lactoferroxin-A)YLGSGYTalactoferrin alfa is a novel immunomodulatory 80 kD protein with demonstrated oral anti-tumor properties. Lactoferrin, a protein found in breast milkAnticancerNot available,15221967,16193240
Disclaimer

The Website is provided “as is” and the DRAMP hereby disclaim all warranties of any kind, express or implied. The DRAMP does not make any warranty that the services will be free of errors. You understand that you download from, or otherwise obtain content or services through, the DRAMP at your own discretion and risk. DRAMP is consturcted by Zheng group.

Creative Commons License This work is licensed under a Creative Commons Attribution 4.0 International License.

Close
Sign in     login

Forgot your password?