General Information

    • DRAMP ID

    • DRAMP00103

    • Peptide Name

    • Bacteriocin OR-7 (Preclinical)

    • Source

    • Lactobacillus salivarius NRRL B-30514 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTFH

    • Sequence Length

    • 54

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Campylobacter jejuni NCTC 11168.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00103 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00103.

Physicochemical Information

    • Formula

    • C280H428N78O77S3

    • Absent Amino Acids

    • EP

    • Common Amino Acids

    • GTK

    • Mass

    • 6215.13

    • PI

    • 9.84

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +8

    • Boman Index

    • -85.09

    • Hydrophobicity

    • -0.646

    • Aliphatic Index

    • 57.78

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 16960

    • Absorbance 280nm

    • 320

    • Polar Residues

    • 24

DRAMP00103

DRAMP00103 chydropathy plot

Comments Information

    • Function

    • OR-7 had activity to a gram-negative bacterium.

    • Biophysicochemical properties

    • Temperature dependence (Remains active after exposure to 90 degrees C for 15 min), pH dependence (Stable from pH 3.0 to 9.1).

Literature Information

  • ·Literature 1

    • Title

    • Isolation of a Lactobacillus salivarius Strain and Purification of Its Bacteriocin, Which Is Inhibitory to Campylobacter jejuni in the Chicken Gastrointestinal System

    • Reference

    • Antimicrob. Agents Chemother. 2006 50 (9):3111-3116.

    • Author

    • Stern NJ, Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Pokhilenko VD, Levchuk VP, Svetoch OE, Seal BS.