General Information

    • DRAMP ID

    • DRAMP00108

    • Peptide Name

    • Leucocin C (Pediocin-like peptide; Bacteriocin)

    • Source

    • Lactococcus lactis MMFI (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • KNYGNGVHCTKKGCSVDWGYAWANIANNSVMNGLTGGNAGWHN

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00108 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00108.

Physicochemical Information

    • Formula

    • C197H289N61O60S3

    • Absent Amino Acids

    • EFPQR

    • Common Amino Acids

    • GN

    • Mass

    • 4568.01

    • PI

    • 8.79

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -51.41

    • Hydrophobicity

    • -0.607

    • Aliphatic Index

    • 47.67

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 19605

    • Absorbance 280nm

    • 466.79

    • Polar Residues

    • 24

DRAMP00108

DRAMP00108 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The complete amino acid sequence of the pediocin-like antimicrobial peptide leucocin C.

    • Reference

    • Biochem Biophys Res Commun 2002; 295: 826-827.

    • Author

    • Fimland G, Sletten K, Nissen-Meyer J.