General Information

    • DRAMP ID

    • DRAMP00130

    • Peptide Name

    • Lactococcin Q alpha (Qalpha; Bacteriocin)

    • Source

    • Lactococcus lactis QU 4 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • laqA

    • Sequence

    • SIWGDIGQGVGKAAYWVGKAMGNMSDVNQASRINRKKKH

    • Sequence Length

    • 39

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Lactococcus lactis subsp. lactis ATCC 19435 (MIC>1000 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00130 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00130.

Physicochemical Information

    • Formula

    • C185H297N59O53S2

    • Absent Amino Acids

    • CEFLPT

    • Common Amino Acids

    • G

    • Mass

    • 4259.88

    • PI

    • 10.29

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +6

    • Boman Index

    • -71.91

    • Hydrophobicity

    • -0.692

    • Aliphatic Index

    • 62.56

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 328.68

    • Polar Residues

    • 13

DRAMP00130

DRAMP00130 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Lactococcin Q, a novel two-peptide bacteriocin produced by Lactococcus lactis QU 4.

    • Reference

    • Appl Environ Microbiol. 2006 May;72(5):3383-3389.

    • Author

    • Zendo T, Koga S, Shigeri Y, Nakayama J, Sonomoto K.