General Information

    • DRAMP ID

    • DRAMP00134

    • Peptide Name

    • Plantaricin NC8 beta peptide (PLNC8 beta; Bacteriocin)

    • Source

    • Lactobacillus plantarum NC8 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • plnc8B

    • Sequence

    • SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH

    • Sequence Length

    • 34

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00134 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00134.

Physicochemical Information

    • Formula

    • C189H288N48O48

    • Absent Amino Acids

    • CDMQ

    • Common Amino Acids

    • K

    • Mass

    • 4000.66

    • PI

    • 10

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +7

    • Boman Index

    • -42.51

    • Hydrophobicity

    • -0.382

    • Aliphatic Index

    • 77.35

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 302.12

    • Polar Residues

    • 13

DRAMP00134

DRAMP00134 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and genetic characterization of plantaricin NC8, a novel coculture-inducible two-peptide bacteriocin from Lactobacillus plantarum NC8.

    • Reference

    • Appl Environ Microbiol. 2003 Jan;69(1):383-339.

    • Author

    • Maldonado A, Ruiz-Barba JL, Jim©nez-D­az R.
  • ·Literature 2

    • Title

    • Induction of plantaricin production in Lactobacillus plantarum NC8 after coculture with specific Gram-positive bacteria: is mediated by an autoinduction mechanism.

    • Reference

    • J Bacteriol. 2004 Mar;186(5):1556-1564.

    • Author

    • Maldonado A, Jim©nez-D­az R, Ruiz-Barba JL.
  • ·Literature 3

    • Title

    • Comparative study of the pln locus of the quorum-sensing regulated bacteriocin-producing Lactobacillus plantarum J51 strain.

    • Reference

    • Int J Food Microbiol. 2008 Dec 10;128(2):390-394.

    • Author

    • Navarro L, Rojo-Bezares B, S¡enz Y, D­ez L, Zarazaga M, Ruiz-Larrea F, Torres C.