General Information

    • DRAMP ID

    • DRAMP00179

    • Peptide Name

    • Enterocin Q (EntQ; Bacteriocin)

    • Source

    • Enterococcus faecium L50 (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • entqA

    • Sequence

    • MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC

    • Sequence Length

    • 34

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • A broad antimicrobial spectrum against the most relevant beer-spoilage lactic acid bacteria (LAB) (i.e., Lactobacillus brevis and Pediococcus damnosus).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00179 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00179.

Physicochemical Information

    • Formula

    • C181H281N45O46S4

    • Absent Amino Acids

    • DHRV

    • Common Amino Acids

    • K

    • Mass

    • 3951.74

    • PI

    • 9.39

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -24.24

    • Hydrophobicity

    • -0.359

    • Aliphatic Index

    • 66.18

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14105

    • Absorbance 280nm

    • 427.42

    • Polar Residues

    • 11

DRAMP00179

DRAMP00179 chydropathy plot

Comments Information

    • Enterococcus faecium L50 produces, in addition to EntL50, the sec-dependent pediocin-like enterocin P (EntP), and an unmodified non-pediocin-like bacteriocin, termed enterocin Q (EntQ), synthesized without an N-terminal leader sequence or signal peptide. (Ref.1)

Literature Information

  • ·Literature 1

    • Title

    • Biochemical and genetic evidence that Enterococcus faecium L50 produces enterocins L50A and L50B, the sec-dependent enterocin P, and a novel bacteriocin secreted without an N-terminal extension termed enterocin Q.

    • Reference

    • J Bacteriol. 2000 Dec;182(23):6806-6814.

    • Author

    • Cintas LM, Casaus P, Herranz C, H¢varstein LS, Holo H, Hern¡ndez PE, Nes IF.
  • ·Literature 2

    • Title

    • Complete sequence of the enterocin Q-encoding plasmid pCIZ2 from the multiple bacteriocin producer Enterococcus faecium L50 and genetic characterization of enterocin Q production and immunity.

    • Reference

    • Appl Environ Microbiol. 2006 Oct;72(10):6653-6666.

    • Author

    • Criado R, Diep DB, Aakra A, Guti©rrez J, Nes IF, Hern¡ndez PE, Cintas LM.