• DRAMP ID

    • DRAMP00225
    • Peptide Name

    • Bacteriocin UviB
    • Source

    • Clostridium perfringens (Gram-positive bacteria)
    • Family

    • Not found
    • Gene

    • uviB
    • Sequence

    • ILFSYLLFYVLKENSKREDKYQNIIEELTELLPKIKEDVEDIKEKLNK
    • Sequence Length

    • 48
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00225 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00225.
    • Formula

    • C271H437N63O81
    • Absent Amino Acids

    • ACGHMW
    • Common Amino Acids

    • EKL
    • Mass

    • 5873.82
    • PI

    • 5.02
    • Basic Residues

    • 9
    • Acidic Residues

    • 11
    • Hydrophobic Residues

    • 17
    • Net Charge

    • -2
    • Boman Index

    • -97.21
    • Hydrophobicity

    • -0.606
    • Aliphatic Index

    • 117.71
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4470
    • Absorbance 280nm

    • 95.11
    • Polar Residues

    • 9

DRAMP00225

DRAMP00225 chydropathy plot
    • Function

    • May have a role in bacteriocin secretion or immunity.
  • ·Literature 1
    • Title

    • Complete nucleotide sequence and genetic organization of the bacteriocinogenic plasmid, pIP404, from Clostridium perfringens.
    • Reference

    • Plasmid. 1988 Mar;19(2):134-150.
    • Author

    • Garnier T, Cole ST.
  • ·Literature 2
    • Title

    • Studies of UV-inducible promoters from Clostridium perfringens in vivo and in vitro.
    • Reference

    • Mol Microbiol. 1988 Sep;2(5):607-614.
    • Author

    • Garnier T, Cole ST.