General Information

    • DRAMP ID

    • DRAMP00225

    • Peptide Name

    • Bacteriocin UviB

    • Source

    • Clostridium perfringens (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • uviB

    • Sequence

    • ILFSYLLFYVLKENSKREDKYQNIIEELTELLPKIKEDVEDIKEKLNK

    • Sequence Length

    • 48

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00225 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00225.

Physicochemical Information

    • Formula

    • C271H437N63O81

    • Absent Amino Acids

    • ACGHMW

    • Common Amino Acids

    • EKL

    • Mass

    • 5873.82

    • PI

    • 5.02

    • Basic Residues

    • 9

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 17

    • Net Charge

    • -2

    • Boman Index

    • -97.21

    • Hydrophobicity

    • -0.606

    • Aliphatic Index

    • 117.71

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4470

    • Absorbance 280nm

    • 95.11

    • Polar Residues

    • 9

DRAMP00225

DRAMP00225 chydropathy plot

Comments Information

    • Function

    • May have a role in bacteriocin secretion or immunity.

Literature Information

  • ·Literature 1

    • Title

    • Complete nucleotide sequence and genetic organization of the bacteriocinogenic plasmid, pIP404, from Clostridium perfringens.

    • Reference

    • Plasmid. 1988 Mar;19(2):134-150.

    • Author

    • Garnier T, Cole ST.
  • ·Literature 2

    • Title

    • Studies of UV-inducible promoters from Clostridium perfringens in vivo and in vitro.

    • Reference

    • Mol Microbiol. 1988 Sep;2(5):607-614.

    • Author

    • Garnier T, Cole ST.