General Information

    • DRAMP ID

    • DRAMP00258

    • Peptide Name

    • Lacticin Z (Bacteriocin)

    • Source

    • Lactococcus lactis

    • Family

    • Not found

    • Gene

    • lnqZ

    • Sequence

    • MAGFLKVVQILAKYGSKAVQWAWANKGKILDWINAGQAIDWVVEKIKQILGIK

    • Sequence Length

    • 53

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00258 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C281H447N71O68S

    • Absent Amino Acids

    • CHPRT

    • Common Amino Acids

    • KAI

    • Mass

    • 5940.13

    • PI

    • 9.9

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +5

    • Boman Index

    • -1.29

    • Hydrophobicity

    • 0.276

    • Aliphatic Index

    • 121.51

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 23490

    • Absorbance 280nm

    • 451.73

    • Polar Residues

    • 9

DRAMP00258

DRAMP00258 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and structure analysis of a novel bacteriocin, lacticin Z, produced by Lactococcus lactis QU 14.

    • Reference

    • Biosci Biotechnol Biochem. 2007 Aug;71(8):1984-1992.

    • Author

    • Iwatani S, Zendo T, Yoneyama F, Nakayama J, Sonomoto K.