General Information

    • DRAMP ID

    • DRAMP03549

    • Peptide Name

    • ALL-38 (Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

    • Sequence Length

    • 38

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03549 helical wheel diagram
  • 2K6O-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03549.

Physicochemical Information

    • Formula

    • C208H345N61O54

    • Absent Amino Acids

    • CHMWY

    • Common Amino Acids

    • K

    • Mass

    • 4564.4

    • PI

    • 10.61

    • Basic Residues

    • 11

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +6

    • Boman Index

    • -109.19

    • Hydrophobicity

    • -0.658

    • Aliphatic Index

    • 89.74

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 6

DRAMP03549

DRAMP03549 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Processing of seminal plasma hCAP-18 to ALL-38 by gastricsin: a novel mechanism of generating antimicrobial peptides in vagina.

    • Reference

    • J Biol Chem. 2003 Aug 1;278(31):28540-6.

    • Author

    • Sørensen OE, Gram L, Johnsen AH, Andersson E, Bangsbøll S, Tjabringa GS, Hiemstra PS, Malm J, Egesten A, Borregaard N.