General Information

    • DRAMP ID

    • DRAMP03551

    • Peptide Name

    • Adrenomedullin (Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

    • Sequence Length

    • 52

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03551 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03551.

Physicochemical Information

    • Formula

    • C264H407N79O78S3

    • Absent Amino Acids

    • EW

    • Common Amino Acids

    • Q

    • Mass

    • 6031.8

    • PI

    • 9.7

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +6

    • Boman Index

    • -135.62

    • Hydrophobicity

    • -0.887

    • Aliphatic Index

    • 45

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 4595

    • Absorbance 280nm

    • 90.1

    • Polar Residues

    • 19

DRAMP03551

DRAMP03551 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • An investigation into the antimicrobial effects of adrenomedullin on members of the skin, oral, respiratory tract and gut microflora.

    • Reference

    • FEMS Immunol Med Microbiol. 1999 Apr;23(4):289-293.

    • Author

    • Allaker RP, Zihni C, Kapas S.