• DRAMP ID

    • DRAMP03600
    • Peptide Name

    • Human beta-defensin 4 (hBD-4, BD-4; Beta-defensin 104; Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB104A
    • Sequence

    • EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
    • Sequence Length

    • 50
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium: Staphylococcus carnosus TM300 (MIC=4.5 µg/ml);
      • Gram-negative bacteria: Escherichia coli BL21 (MIC>100 µg/ml), Pseudomonas aeruginosa (MIC=4.1 µg/ml).
      • Yeast: Saccharomyces cerevisiae ATCC9763 (MIC>100 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys8 and Cys36,Cys15 and Cys29,Cys19 and Cys37.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03600 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP03600.
    • Formula

    • C254H410N82O74S6
    • Absent Amino Acids

    • HMV
    • Common Amino Acids

    • R
    • Mass

    • 5988.91
    • PI

    • 9.27
    • Basic Residues

    • 12
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +6
    • Boman Index

    • -171.04
    • Hydrophobicity

    • -1.008
    • Aliphatic Index

    • 50.8
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10345
    • Absorbance 280nm

    • 211.12
    • Polar Residues

    • 19

DRAMP03600

DRAMP03600 chydropathy plot
    • Function

    • Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103.
    • Tissue specificity

    • High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested.
    • Induction

    • Antimicrobial activity is decreased when the sodium chloride concentration is increased.
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity.
    • Reference

    • FASEB J. 2001 Aug;15(10):1819-1821.
    • Author

    • García JR, Krause A, Schulz S, Rodríguez-Jiménez FJ, Klüver E, Adermann K, Forssmann U, Frimpong-Boateng A, Bals R, Forssmann WG.